BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0387 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8333| Best HMM Match : BRCT (HMM E-Value=2.2) 29 3.1 SB_43850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_8333| Best HMM Match : BRCT (HMM E-Value=2.2) Length = 181 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 491 YYSIILSCLYTTRKSNKFSN 550 YYSI+L+CL+ + NK SN Sbjct: 162 YYSIVLNCLFGKARKNKKSN 181 >SB_43850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -1 Query: 327 PCDMSSKSQLLQ--YSGYPIIQAETQAVSQQK*AGREKLPVLTKIVF 193 PC ++ S L Q Y +P+++ + A SQ K E +LTK+ F Sbjct: 949 PCSLNISSPLAQSAYCDFPLMRLKKFAWSQVKAGAPEVYHLLTKMYF 995 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,596,568 Number of Sequences: 59808 Number of extensions: 334670 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -