BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0385 (627 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 0.91 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 3.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 24.2 bits (50), Expect = 0.91 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 238 FIYTYCNREIRXLNASDXFFWSAGRTF 318 F Y Y + IR ++ FFWS R + Sbjct: 553 FCYCYYSISIRPISTLGWFFWSLLRIY 579 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -1 Query: 483 TPLLYQGSDSGPRECKGSR 427 TP Y GPR C G R Sbjct: 423 TPYTYLPFGEGPRNCIGQR 441 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 432 SPCTLSAQSQNLGRVGGSRGQHYNQTAAPSLGCPNRQF 545 SPC SA + R G R + ++ SLG + F Sbjct: 929 SPCRNSASPASSDRSGTPRSTNGDRKPGGSLGALSSMF 966 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 163 VTTTYRDQKMEIGNYLT 213 V TY + K EIG Y+T Sbjct: 1260 VNFTYFEDKNEIGVYIT 1276 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 163 VTTTYRDQKMEIGNYLT 213 V TY + K EIG Y+T Sbjct: 1260 VNFTYFEDKNEIGVYIT 1276 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,378 Number of Sequences: 336 Number of extensions: 3437 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -