Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0384
         (573 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1289 - 25923916-25924586,25925148-25926630                       27   8.0  

>08_02_1289 - 25923916-25924586,25925148-25926630
          Length = 717

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 11/38 (28%), Positives = 23/38 (60%)
 Frame = +2

Query: 455 SIQYIFMVVGPLVSPHGYTTLPNLVLNTRWAXSSSNHS 568
           ++QY++  +  L  PHG+    N++LN R+    +++S
Sbjct: 519 ALQYLYDELPMLTVPHGHLKSSNILLNDRFEPLLTDYS 556


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,721,855
Number of Sequences: 37544
Number of extensions: 212632
Number of successful extensions: 317
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 315
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 317
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1328870592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)