BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0384 (573 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28738-3|AAA68310.2| 468|Caenorhabditis elegans Hypothetical pr... 30 1.0 Z78540-2|CAB01737.1| 900|Caenorhabditis elegans Hypothetical pr... 28 4.1 >U28738-3|AAA68310.2| 468|Caenorhabditis elegans Hypothetical protein T28D9.4 protein. Length = 468 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 457 GLILMKY*HILFDICEY*TELKLLSTFNLE*INAVFSN-ILEFL 329 GL+ HIL D +Y E+KLL TFN+ + + N ILE L Sbjct: 101 GLLTPPMKHILEDRTKYKNEIKLLKTFNVHLTYSTWINSILEIL 144 >Z78540-2|CAB01737.1| 900|Caenorhabditis elegans Hypothetical protein C33G3.4 protein. Length = 900 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 467 IFMVVGPLVSPHGYTTLPNLVLNTRWAXSSSN 562 +F ++ L + HGY TL NL N W SSSN Sbjct: 9 LFWLLFQLHTTHGYNTLVNLAGN--WEFSSSN 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,660,695 Number of Sequences: 27780 Number of extensions: 218929 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1184216096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -