BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0383 (700 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HQ21 Cluster: Methylated DNA-protein cysteine methylt... 54 4e-06 UniRef50_A0YS62 Cluster: Putative uncharacterized protein; n=1; ... 35 2.2 UniRef50_UPI0000E48573 Cluster: PREDICTED: similar to CG32645-PB... 33 8.9 >UniRef50_Q1HQ21 Cluster: Methylated DNA-protein cysteine methyltransferase; n=1; Bombyx mori|Rep: Methylated DNA-protein cysteine methyltransferase - Bombyx mori (Silk moth) Length = 136 Score = 53.6 bits (123), Expect = 4e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 389 VSSYFV*FTSNTANVNPSHNTAVCIQKLQK 300 + S F FTSNTANVNPSHNTAVCIQKLQK Sbjct: 107 LGSDFQKFTSNTANVNPSHNTAVCIQKLQK 136 >UniRef50_A0YS62 Cluster: Putative uncharacterized protein; n=1; Lyngbya sp. PCC 8106|Rep: Putative uncharacterized protein - Lyngbya sp. PCC 8106 Length = 329 Score = 34.7 bits (76), Expect = 2.2 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -2 Query: 216 LINNIKF*TKLPIFNHRYKCWPRLGQHMDKLLLNRTVNAWSRFVL 82 L+ KF TK+P F H K W + +H+DK + T N+ +F+L Sbjct: 228 LLTYDKFETKIPYFIHNGKKWVKRNEHLDKYVDQNTNNS-RKFIL 271 >UniRef50_UPI0000E48573 Cluster: PREDICTED: similar to CG32645-PB; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG32645-PB - Strongylocentrotus purpuratus Length = 545 Score = 32.7 bits (71), Expect = 8.9 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +2 Query: 194 QNLILFISLKLTI*FILHVLTNVRYSGR*IAFSGLIFATFEYTLRYCETG*HWLCLK*TK 373 + L+L L I ++ V NV Y+ R G + + YTL + + G WLC K Sbjct: 45 ETLVLASCLTDLIRLLVDVSLNVEYASRMWVSRGKLDESAFYTLLFKDPGNRWLCQS-VK 103 Query: 374 QNKSS 388 +NK+S Sbjct: 104 ENKTS 108 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,184,531 Number of Sequences: 1657284 Number of extensions: 13010965 Number of successful extensions: 24092 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24090 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -