BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0382 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 27 0.23 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 4.9 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 6.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 8.6 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 26.6 bits (56), Expect = 0.23 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 464 LSIVMRPPVTFFCNF*PLMSVSGTVKC 384 +++++ PP FFC P+ V + C Sbjct: 125 MTVILTPPGRFFCEVRPIKRVKDSTNC 151 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/46 (21%), Positives = 24/46 (52%) Frame = -3 Query: 491 PLPSVDRSLLSIVMRPPVTFFCNF*PLMSVSGTVKCVAQSHVQTLR 354 P ++D + V+ ++F+ ++ + + C AQ HV+++R Sbjct: 182 PTCALDLTPTYAVVSSSISFYVPCIVMLGIYCRLYCYAQKHVKSIR 227 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -2 Query: 549 VFLYFETMLAYKPLAIKVD 493 +FLYF +++ ++ I++D Sbjct: 23 IFLYFNSLVRFRRFTIELD 41 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 8.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -1 Query: 94 KERHLCVLKSVRC 56 K +C+LKS+ C Sbjct: 154 KNERICILKSITC 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,031 Number of Sequences: 438 Number of extensions: 3767 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -