BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0381 (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces p... 30 0.28 SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 27 3.4 SPBC1734.15 |rsc4|brd1|RSC complex subunit Rsc4|Schizosaccharomy... 26 4.5 >SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 30.3 bits (65), Expect = 0.28 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 Query: 486 ATGWYSQGCVESSLSLDGRTSSRPAQCKWLPEPIDIYNVNAPPT 617 A+G YSQ E+SL R + K LPE DIY ++ P+ Sbjct: 331 ASGPYSQEEEETSLFKSQRKEENEEESKELPEDSDIYGKDSSPS 374 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 448 YDDKQLVPDCRVEWAMQLNSTSVCRSPLSFSPD 350 YD + + R +W M + CR FSPD Sbjct: 223 YDRRMVKKSFRDDWTMNTSPEKDCRCVRKFSPD 255 >SPBC1734.15 |rsc4|brd1|RSC complex subunit Rsc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 542 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 363 LSGLRHTEVEFNCIAHSTLQSGTNCL 440 L G++HTE + + L G NCL Sbjct: 476 LEGIKHTEEPIRTVYEAKLSVGLNCL 501 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,747,414 Number of Sequences: 5004 Number of extensions: 52939 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -