BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0381 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12675| Best HMM Match : Cornichon (HMM E-Value=2.3) 28 8.3 >SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 3.6 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Frame = -3 Query: 544 VLPSKEREDSTQP*----LYQPVARASSHNPLGY*YYDDKQLV---PDCRVEWAMQLN 392 VLPS E+ +S +P L +P R SSH+P YY+ +V PD QLN Sbjct: 20 VLPSMEQSNSCRPGDPLVLERPPPRWSSHSPYSESYYNSLAVVLQRPDWENPGVTQLN 77 >SB_12675| Best HMM Match : Cornichon (HMM E-Value=2.3) Length = 225 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 636 LTTYISRWVARLRCRCLWAPVTTYIGLVVS 547 +T YI+R+V R RCL VT Y+ V+ Sbjct: 57 VTRYITRYVTRYLTRCLTRYVTRYMSRYVT 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,664,591 Number of Sequences: 59808 Number of extensions: 408025 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -