BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0381 (693 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT030434-1|ABO52854.1| 492|Drosophila melanogaster IP18315p pro... 30 3.4 AE014296-247|AAN11477.1| 469|Drosophila melanogaster CG32320-PA... 30 3.4 >BT030434-1|ABO52854.1| 492|Drosophila melanogaster IP18315p protein. Length = 492 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 669 WWGSRCNYT*DLTTYISRWVARLRCRCLWAPVTTYIG 559 W+ SR N+ LT Y++R+ CRCL ++IG Sbjct: 378 WFNSRLNWY-ALTLYLNRFKHNPHCRCLSCFTVSFIG 413 >AE014296-247|AAN11477.1| 469|Drosophila melanogaster CG32320-PA protein. Length = 469 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 669 WWGSRCNYT*DLTTYISRWVARLRCRCLWAPVTTYIG 559 W+ SR N+ LT Y++R+ CRCL ++IG Sbjct: 422 WFNSRLNWY-ALTLYLNRFKHNPHCRCLSCFTVSFIG 457 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,198,722 Number of Sequences: 53049 Number of extensions: 603315 Number of successful extensions: 1263 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3026039247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -