BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0381 (693 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical... 28 7.3 AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical... 28 7.3 >AL032623-17|CAN86638.1| 1398|Caenorhabditis elegans Hypothetical protein Y43F8B.3b protein. Length = 1398 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 486 ATGWYSQGCVESSLSLDGRTSSRPAQCKWLPEPIDIYNVNAPPTLRY 626 A W G V + + P C+ LPE + APPT R+ Sbjct: 665 ADHWCHLGLVPDEYQCCPGSPTNPGACQGLPESEGVTGAPAPPTSRW 711 >AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical protein Y43F8B.3a protein. Length = 1816 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 486 ATGWYSQGCVESSLSLDGRTSSRPAQCKWLPEPIDIYNVNAPPTLRY 626 A W G V + + P C+ LPE + APPT R+ Sbjct: 1083 ADHWCHLGLVPDEYQCCPGSPTNPGACQGLPESEGVTGAPAPPTSRW 1129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,158,528 Number of Sequences: 27780 Number of extensions: 301723 Number of successful extensions: 501 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -