BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0380 (658 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC013757-1|AAH13757.1| 403|Homo sapiens LRRC58 protein protein. 65 2e-10 >BC013757-1|AAH13757.1| 403|Homo sapiens LRRC58 protein protein. Length = 403 Score = 64.9 bits (151), Expect = 2e-10 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 1/108 (0%) Frame = -3 Query: 413 QLSLRDNPLVVRSVRDMTLQPPSLLELAGRTVKLHNIPIETGGIPKTLINYLQQPNVVSI 234 +LSLR NPLVVR VRD+T PP+LLELA RT+K+ NI +P L+ YL + + Sbjct: 271 ELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSAS--NC 328 Query: 233 QNAKV***YYYCNI-*IVFVLACVQIRPSYLNNKYTLYKVEPRCVHHC 93 N K Y+ C + I FV C + R ++ Y P C C Sbjct: 329 PNPKCGGVYFDCCVRQIKFVDFCGKYRLPLMH-----YLCSPECSSPC 371 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,838,195 Number of Sequences: 237096 Number of extensions: 2059459 Number of successful extensions: 2848 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2840 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -