Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0379
         (701 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6ETH3 Cluster: Putative lipopolysaccharide biosynthesi...    33   5.1  

>UniRef50_A6ETH3 Cluster: Putative lipopolysaccharide biosynthesis
           protein; n=1; unidentified eubacterium SCB49|Rep:
           Putative lipopolysaccharide biosynthesis protein -
           unidentified eubacterium SCB49
          Length = 477

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)
 Frame = +1

Query: 391 WPTITYSYYIYGQR----------VLAATRVKRHLKFYFNVFL--IVYCIYNSIYYYKLG 534
           W  ITYS+ +  Q           V   T+  RH KF + + L  +V  I+N+IYY  LG
Sbjct: 174 WGAITYSFIVSAQYWFYSNWRPNFVFNKTKFNRHFKFGYKLTLAGLVNIIFNNIYYIILG 233

Query: 535 VFLCIKR 555
            +  I +
Sbjct: 234 KYFSINQ 240


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 558,631,717
Number of Sequences: 1657284
Number of extensions: 9232918
Number of successful extensions: 21576
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21573
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)