BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0379 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 26 0.34 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.79 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 1.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 1.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 1.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 1.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 1.4 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 1.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.4 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 2.4 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 7.4 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 7.4 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 7.4 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.4 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 7.4 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 25.8 bits (54), Expect = 0.34 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 268 VNYNHSNFFFICCSSHRQFFRLAAFRFIVRLYRLSPLS 155 VN N++ IC ++H+Q F+L + +V + PL+ Sbjct: 204 VNENNTTVNNICQATHKQLFQLVQWAKLVPHFTSLPLT 241 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 460 HLKFY--FNVFLIVYCIYNSIYYYKLGVFLCI 549 HL FY F +F + + + +YY + LC+ Sbjct: 82 HLLFYCPFIIFTVHFLLCTYYFYYAFIILLCV 113 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +1 Query: 469 FYFNVFLIVYCIYNSIYYYKLGVF 540 +++ F+I+ C+Y +YY +F Sbjct: 102 YFYYAFIILLCVY--YFYYAFIIF 123 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVLAATRVKRHLK 468 K +W Y Y++ G R L + H K Sbjct: 120 KKRWSQCMYMYFLLGFRYLVNDELSAHSK 148 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVLAATRVKRHLK 468 K +W Y Y++ G R L + H K Sbjct: 434 KKRWSQCMYMYFLLGFRYLVNDELSAHSK 462 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.4 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVL 438 + +W + Y YY+ G R++ Sbjct: 695 RKRWSQVMYMYYLLGHRLM 713 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.4 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVL 438 + +W + Y YY+ G R++ Sbjct: 695 RKRWSQVMYMYYLLGHRLM 713 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVLAATRVKRHLK 468 K +W Y Y++ G R+ A + H K Sbjct: 667 KKRWSQCMYMYFLLGFRLQANDELSAHSK 695 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVLAATRVKRHLK 468 K +W Y Y++ G R+ A + H K Sbjct: 667 KKRWSQCMYMYFLLGFRLQANDELSAHSK 695 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.4 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVL 438 + +W + Y YY+ G R++ Sbjct: 695 RKRWSQVMYMYYLLGHRLM 713 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.8 bits (49), Expect = 1.4 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 382 KSQWPTITYSYYIYGQRVL 438 + +W + Y YY+ G R++ Sbjct: 695 RKRWSQVMYMYYLLGHRLM 713 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 466 LSDASLGLLPKLSDHIYNKNK*WWATEI 383 L+D S+GL+ L+D I+ W+A + Sbjct: 68 LADLSVGLINVLTDIIWKTTVAWYAGNV 95 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 46 ISFTLSLFYKKKKITYLI 99 ISF +F+K KK+ YL+ Sbjct: 155 ISFESKVFHKLKKMKYLV 172 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +1 Query: 457 RHLKFYFNVFLIVYCIYNSIYYYKLGVFLCIK 552 + ++ + F VY +YN + +G+F +K Sbjct: 57 QEIRLEWKSFRFVYAVYNIFGAFVMGLFCILK 88 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +3 Query: 12 LIFHVV*FMYQHFFHPIIVLQKKKNYLFDNIRKLSTFIIH 131 ++F ++ Y F ++ + K Y F+ I+ S FI++ Sbjct: 108 VLFQLIHVYYTVVFTLLLGVDFVKEYAFEYIQLYSQFILY 147 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +3 Query: 12 LIFHVV*FMYQHFFHPIIVLQKKKNYLFDNIRKLSTFIIH 131 ++F ++ Y F ++ + K Y F+ I+ S FI++ Sbjct: 108 VLFQLIHVYYTVVFTLLLGVDFVKEYAFEYIQLYSQFILY 147 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +3 Query: 12 LIFHVV*FMYQHFFHPIIVLQKKKNYLFDNIRKLSTFIIH 131 ++F ++ Y F ++ + K Y F+ I+ S FI++ Sbjct: 428 VLFQLIHVYYTVVFTLLLGVDFVKEYAFEYIQLYSQFILY 467 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 111 LSTFIIHSF*IRQ*ADKGLSL 173 L TF+I F +++ A KGL L Sbjct: 63 LGTFLISGFQMQKIATKGLDL 83 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 111 LSTFIIHSF*IRQ*ADKGLSL 173 L TF+I F +++ A KGL L Sbjct: 63 LGTFLISGFQMQKIATKGLDL 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,148 Number of Sequences: 336 Number of extensions: 2982 Number of successful extensions: 24 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -