BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0378 (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 3.4 SPAC23H3.11c |||glucosidase |Schizosaccharomyces pombe|chr 1|||M... 26 4.5 SPCC613.01 ||SPCC757.14|membrane transporter|Schizosaccharomyces... 25 7.9 SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pom... 25 7.9 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 26.6 bits (56), Expect = 3.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 349 NSCLKHRQQAPYRLSINKRNHSRQKVTYY 435 + CLKH Y+ + KR+HSR + ++ Sbjct: 90 DQCLKHNIPCIYKSNSTKRSHSRHEEIHH 118 >SPAC23H3.11c |||glucosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 629 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 70 KLCDFFFLFSVSLGLNV 20 + CD FFLF +SLG+ + Sbjct: 158 RFCDLFFLFVLSLGIGL 174 >SPCC613.01 ||SPCC757.14|membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 497 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +3 Query: 24 FKPKETLNRKKKSHNFTPRVP------AKKSLNNIQVFQVP 128 +KP+ET R +S TP V +K + NI++ ++P Sbjct: 13 YKPQETQRRLSRSSTITPSVSEYRSGFSKTAFGNIELEEIP 53 >SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 163 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 449 ISLHLISFIFTLIDY*F 499 IS+HL+ ++TLIDY F Sbjct: 63 ISVHLMPTVYTLIDYLF 79 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,578,102 Number of Sequences: 5004 Number of extensions: 46471 Number of successful extensions: 115 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -