BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0378 (699 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22181-2|CAA80180.1| 510|Caenorhabditis elegans Hypothetical pr... 28 7.4 AL117207-8|CAB60399.1| 362|Caenorhabditis elegans Hypothetical ... 28 7.4 >Z22181-2|CAA80180.1| 510|Caenorhabditis elegans Hypothetical protein ZK632.3 protein. Length = 510 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 580 RLLRAISFFKF*GPQ*IKIWALKNVNWDFFSDSLQWN 690 ++ R + F G Q + LKNV W+FF+D + N Sbjct: 330 KVRRNVLVMSFLGDQGLAAPRLKNVEWEFFTDDERRN 366 >AL117207-8|CAB60399.1| 362|Caenorhabditis elegans Hypothetical protein Y60A3A.14 protein. Length = 362 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 374 CCLCFKQEF-FSAKNYLXGWRHLIQLYF 294 C F Q F FSA+N W H I LYF Sbjct: 152 CLFNFVQIFRFSAENSTGFWHHTISLYF 179 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,039,647 Number of Sequences: 27780 Number of extensions: 255004 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -