SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0377
         (700 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK057033-1|BAB71351.1|  246|Homo sapiens protein ( Homo sapiens ...    43   0.001

>AK057033-1|BAB71351.1|  246|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32471 fis, clone SKNMC2000322, weakly similar to
           MAJOR CENTROMERE AUTOANTIGEN B. ).
          Length = 246

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = -3

Query: 206 LAVI*HEDQTQKSSLLSTMTVMTKAKRLFAMLKAKV-*PVYDAEFTASSGLFK*FKN*CS 30
           L V+  EDQ QK   LS + +  KA+ LF MLK +   P Y   F AS G F+ FK   +
Sbjct: 92  LLVMWMEDQIQKRIPLSLLMIQAKARSLFNMLKDRASDPTYTQMFKASHGWFQRFKRRHN 151

Query: 29  LHDGKV 12
            H+ K+
Sbjct: 152 FHNVKI 157


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,176,329
Number of Sequences: 237096
Number of extensions: 2200378
Number of successful extensions: 7857
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7643
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7857
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -