BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0376 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56663| Best HMM Match : F420_oxidored (HMM E-Value=0) 29 3.6 SB_5105| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-09) 28 8.4 >SB_56663| Best HMM Match : F420_oxidored (HMM E-Value=0) Length = 630 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +3 Query: 504 YYIKLLCHFLVPILGVLINTVVP*ILVCRPVFCSNI 611 +Y +L+C+ L+ I+GV+ N +V ++VCR N+ Sbjct: 19 FYARLICYVLIFIIGVIGNILVC-LVVCRQRKMKNV 53 >SB_5105| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-09) Length = 438 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 166 LSLSNFIYVVK*KMYFILVLIYFI 237 LSL +F ++ K+YFIL+LIY + Sbjct: 157 LSLGDFTPLIPWKIYFILMLIYLL 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,968,808 Number of Sequences: 59808 Number of extensions: 349014 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -