BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0375 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26330.1 68417.m03786 subtilase family protein contains simil... 31 0.97 At3g25280.1 68416.m03157 proton-dependent oligopeptide transport... 28 5.2 >At4g26330.1 68417.m03786 subtilase family protein contains similarity to SBT1, a subtilase from tomato plants GI:1771160 from [Lycopersicon esculentum] Length = 746 Score = 30.7 bits (66), Expect = 0.97 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +1 Query: 589 IYFIDLVFPIIMGVIIWPELSIY 657 +YF+D++ P+ + V+IWP + ++ Sbjct: 670 VYFVDIIRPVGVEVLIWPRILVF 692 >At3g25280.1 68416.m03157 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 521 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/39 (35%), Positives = 26/39 (66%) Frame = +1 Query: 475 VSTYS*QQYLIISIKLFYFFDINSKSRFFLTILMKLLNI 591 +ST+S QQ ++++ KLF+ F+I S + ++ LL+I Sbjct: 317 LSTFSAQQGMLMNKKLFHSFEIPVPSLTAIPLIFMLLSI 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,544,066 Number of Sequences: 28952 Number of extensions: 216220 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -