BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0373 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64841-2|AAB04846.2| 337|Caenorhabditis elegans Serpentine rece... 28 5.6 U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel t... 28 5.6 DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-t... 28 5.6 AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-t... 28 5.6 >U64841-2|AAB04846.2| 337|Caenorhabditis elegans Serpentine receptor, class t protein14 protein. Length = 337 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = -3 Query: 302 LFVYV*PLHYIFSLNYAFKIQFYKTKEILNLI*NLHLCDIIRLFTFIYTSIKY 144 L++Y+ H IF Y + YKTK+ + +I + LC + +IY +++ Sbjct: 194 LYIYL-CYHLIFKFGYTTSMWMYKTKQQI-IIQAVILCSFHAIAAYIYVYMQF 244 >U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 2 protein. Length = 1785 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = -3 Query: 506 EFIEYSVMSLSDI*FKVRYLSSGWCNPAKCNTFT*KIRQVKDFSEGAMWRSVI 348 EF+E S ++ +I FKVR + SG P+K T IR V S + S++ Sbjct: 710 EFVETSDDTIQEIGFKVRSMLSG-RGPSKETRITTTIRHVGQLSNKTILTSML 761 >DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1763 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = -3 Query: 506 EFIEYSVMSLSDI*FKVRYLSSGWCNPAKCNTFT*KIRQVKDFSEGAMWRSVI 348 EF+E S ++ +I FKVR + SG P+K T IR V S + S++ Sbjct: 688 EFVETSDDTIQEIGFKVRSMLSG-RGPSKETRITTTIRHVGQLSNKTILTSML 739 >AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1785 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = -3 Query: 506 EFIEYSVMSLSDI*FKVRYLSSGWCNPAKCNTFT*KIRQVKDFSEGAMWRSVI 348 EF+E S ++ +I FKVR + SG P+K T IR V S + S++ Sbjct: 710 EFVETSDDTIQEIGFKVRSMLSG-RGPSKETRITTTIRHVGQLSNKTILTSML 761 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,361,327 Number of Sequences: 27780 Number of extensions: 272439 Number of successful extensions: 510 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -