BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0372 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1066 - 27323493-27323936 28 8.2 01_06_1468 + 37574124-37574180,37574275-37574346,37574437-375745... 28 8.2 >06_03_1066 - 27323493-27323936 Length = 147 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 269 LTEILTRS*DIATNTYGASNDRVDNEFPSARV 174 LTE + DI N Y A+ +N+FPS R+ Sbjct: 8 LTEATSAIHDITVNGYSATKSGGENDFPSRRL 39 >01_06_1468 + 37574124-37574180,37574275-37574346,37574437-37574513, 37574897-37574978,37576005-37576069,37576313-37576354, 37576452-37576503,37576631-37576679,37576784-37576797, 37576942-37577049,37577129-37577272,37577421-37577810 Length = 383 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 371 TLPPGASSVNENCAIL 324 TLPPG S +N+ C +L Sbjct: 184 TLPPGVSGINDRCTLL 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,810,621 Number of Sequences: 37544 Number of extensions: 229360 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -