BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0372 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031627-1|CAA20945.1| 550|Caenorhabditis elegans Hypothetical ... 30 1.4 U58740-2|AAD32276.1| 191|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z82259-10|CAD36480.1| 439|Caenorhabditis elegans Hypothetical p... 29 4.2 AL022473-2|CAA18549.2| 439|Caenorhabditis elegans Hypothetical ... 29 4.2 AF332211-1|AAK17982.1| 439|Caenorhabditis elegans nuclear recep... 29 4.2 >AL031627-1|CAA20945.1| 550|Caenorhabditis elegans Hypothetical protein Y102A5C.4 protein. Length = 550 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 530 RRDGFLRFEYFSQTFHILIISKQMTVMVFLLYIWVLKVSTIY 405 R GF R + +SQ L+I+ Q T++ LY W+ + + +Y Sbjct: 441 RSVGFQRQKTYSQQLRTLLITHQPTLVNMPLYSWIFQNNYLY 482 >U58740-2|AAD32276.1| 191|Caenorhabditis elegans Hypothetical protein R09H3.3 protein. Length = 191 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 233 TNTYGASNDRVDNEFPSARVISHQSL 156 TN G +N+ ++N F S ++HQSL Sbjct: 149 TNAIGITNEDIENSFASGDQLAHQSL 174 >Z82259-10|CAD36480.1| 439|Caenorhabditis elegans Hypothetical protein H27C11.1a protein. Length = 439 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 365 PPGASSVNENCAILSTC*LCGQTKCRLSYLY 273 PP VNE AI + C +CG C S+LY Sbjct: 19 PPSPPLVNEKAAIGALCVVCGDRAC--SHLY 47 >AL022473-2|CAA18549.2| 439|Caenorhabditis elegans Hypothetical protein H27C11.1a protein. Length = 439 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 365 PPGASSVNENCAILSTC*LCGQTKCRLSYLY 273 PP VNE AI + C +CG C S+LY Sbjct: 19 PPSPPLVNEKAAIGALCVVCGDRAC--SHLY 47 >AF332211-1|AAK17982.1| 439|Caenorhabditis elegans nuclear receptor NHR-97 protein. Length = 439 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 365 PPGASSVNENCAILSTC*LCGQTKCRLSYLY 273 PP VNE AI + C +CG C S+LY Sbjct: 19 PPSPPLVNEKAAIGALCVVCGDRAC--SHLY 47 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,322,461 Number of Sequences: 27780 Number of extensions: 224174 Number of successful extensions: 491 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -