BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0371 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0861 + 7152976-7153061,7153222-7153310,7154862-7155013,715... 29 3.5 >07_01_0861 + 7152976-7153061,7153222-7153310,7154862-7155013, 7155254-7155382,7155465-7155581,7156353-7156496, 7156749-7156851,7157471-7157565,7157953-7158096 Length = 352 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 188 IVCTIDNIYIFLIDCAYHAFRIEWL-NPKFLFFG 286 IV T+D + +++ C H +++W+ N KF+ G Sbjct: 270 IVATVDAVCLYIWHCGTHRPKLQWICNVKFMMKG 303 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,305,437 Number of Sequences: 37544 Number of extensions: 277450 Number of successful extensions: 417 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -