BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0369 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20486| Best HMM Match : BacA (HMM E-Value=0.92) 32 0.51 SB_50589| Best HMM Match : Neur_chan_memb (HMM E-Value=9.2e-05) 28 8.4 SB_31365| Best HMM Match : Neur_chan_memb (HMM E-Value=1.5e-06) 28 8.4 >SB_20486| Best HMM Match : BacA (HMM E-Value=0.92) Length = 682 Score = 31.9 bits (69), Expect = 0.51 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 310 FCYL--VILLMIYFYESVFSD*ECRNVSKVSFYRYVDKFQSAFIYLVFLGWTCYFM 471 FC + VIL+M+YFY EC K YRY F+ + Y +LG T F+ Sbjct: 221 FCEIATVILVMVYFYA------ECLQADKEGLYRY---FRDPYNYFDWLGLTLTFL 267 >SB_50589| Best HMM Match : Neur_chan_memb (HMM E-Value=9.2e-05) Length = 131 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 379 NVSKVSFYRYVDKFQSAFIYLVFLGWTCYFMRSLPCGHRVHRH 507 ++ KVS+ + +DKF + + VFL Y + + G R RH Sbjct: 69 SMPKVSYVKSIDKFLISCLIFVFLSLIEYCVILILDGKRTRRH 111 >SB_31365| Best HMM Match : Neur_chan_memb (HMM E-Value=1.5e-06) Length = 213 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 379 NVSKVSFYRYVDKFQSAFIYLVFLGWTCYFMRSLPCGHRVHRH 507 ++ KVS+ + +DKF + + VFL Y + + G R RH Sbjct: 118 SMPKVSYVKSIDKFLISCLIFVFLSLIEYCVILILDGKRTRRH 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,022,048 Number of Sequences: 59808 Number of extensions: 301967 Number of successful extensions: 470 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -