BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0368 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27F1.09c |prp10|sap155|U2 snRNP-associated protein Sap155|Sc... 26 6.0 SPBC83.13 |||mitochondrial tricarboxylic acid transporter|Schizo... 26 6.0 >SPAC27F1.09c |prp10|sap155|U2 snRNP-associated protein Sap155|Schizosaccharomyces pombe|chr 1|||Manual Length = 1188 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 476 FLNIFCKREK--QGCANSIRIIQYILLLLEVNIFNEEKN 366 FL C+ +K Q +RIIQ I LLL +I KN Sbjct: 531 FLKAVCRSKKSWQARHTGVRIIQQIALLLGCSILPHLKN 569 >SPBC83.13 |||mitochondrial tricarboxylic acid transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 320 LYFNSGLEIVKRPTNDINLHRNQISKYSSNLARLNLQRYLTKPLR 186 LY G+ + R N + L Q++ + S LA L R+L KP+R Sbjct: 153 LYKEKGIRGINRGVNAVALR--QMTNWGSRLA---LSRFLEKPIR 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,086,452 Number of Sequences: 5004 Number of extensions: 38226 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -