BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0368 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0231 + 14014243-14014390,14015053-14015141,14017859-140179... 28 8.3 >01_03_0231 + 14014243-14014390,14015053-14015141,14017859-14017949, 14018088-14018215,14018703-14018784,14019022-14019081, 14019160-14019251,14019342-14019462,14019873-14019928, 14020193-14020272,14020774-14020820,14020940-14020989, 14021304-14021366,14021515-14021595,14021703-14021717, 14021875-14021985,14022072-14022147,14022350-14022492, 14022721-14022794,14023364-14023454,14023589-14023687 Length = 598 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -1 Query: 425 RIIQYILLLLEVNIFNEEK-N*HYNLDKIPSGRNGLLYFNSGLEIVKRPTNDIN 267 R +I L+ ++++ ++ YN DK+P G+ G +++KR +N I+ Sbjct: 249 RTASFISLICDISMMKQQMVEIGYNADKLPLGKLSKSTILKGYDVLKRISNVIS 302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,019,918 Number of Sequences: 37544 Number of extensions: 170064 Number of successful extensions: 203 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -