BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0367 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0249 - 3284107-3286377 29 3.6 11_01_0692 - 5700394-5700474,5700546-5702675,5705033-5706169,570... 29 4.7 >04_01_0249 - 3284107-3286377 Length = 756 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = -2 Query: 451 VMSHARFGRWLLRKKKPGALSFWSRQICLVNKINPMVYYKK*ARSLNSGSVSFKR 287 ++S R L KKP WS+ I N ++ Y+ AR+ N S FKR Sbjct: 364 IVSDLNLFRILDNNKKPTRYRMWSQTIGQYNLLHECTRYESEARTKNWKSGMFKR 418 >11_01_0692 - 5700394-5700474,5700546-5702675,5705033-5706169, 5709679-5709975 Length = 1214 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 123 LHFFSIKRTKAQIITQVYNYLTKVEY-NSKTLYFYVEPLS 239 L+ S K ++ T+V LTK+EY N T +FY E L+ Sbjct: 714 LNLSSCSYMKGRLETEVLGTLTKLEYLNLSTEHFYTERLA 753 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,629,868 Number of Sequences: 37544 Number of extensions: 368097 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -