BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0367 (701 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49909-17|CAD60413.1| 303|Caenorhabditis elegans Hypothetical p... 29 4.3 Z82288-1|CAB05322.2| 479|Caenorhabditis elegans Hypothetical pr... 28 7.4 >Z49909-17|CAD60413.1| 303|Caenorhabditis elegans Hypothetical protein C14A4.15 protein. Length = 303 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +1 Query: 337 NKPWDLFCLPD----KFVVTRKIRHPVFFSSTTNVQTS 438 + PW LFCL KF+ RKIR +F ++ + ++TS Sbjct: 267 SNPWLLFCLSSTFRHKFLEARKIRR-IFAAAPSTIETS 303 >Z82288-1|CAB05322.2| 479|Caenorhabditis elegans Hypothetical protein ZK896.1 protein. Length = 479 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 135 SIKRTKAQIITQVYNYLTKVEYNSKTLYFYVEPLSAL 245 S+ T + +T NY T++ K L+F+++P + L Sbjct: 81 SVDSTSSFTVTDSANYTTQITSAKKELFFWMDPSATL 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,094,402 Number of Sequences: 27780 Number of extensions: 354108 Number of successful extensions: 801 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -