BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0366 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP16F5.07 |apm1||AP-1 adaptor complex subunit Apm1 |Schizosacc... 33 0.052 SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosac... 30 0.28 SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||... 26 4.5 >SPBP16F5.07 |apm1||AP-1 adaptor complex subunit Apm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 32.7 bits (71), Expect = 0.052 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +3 Query: 12 YLKVFEPKLNYSDHDVIKWVRYIGRSG 92 YLK+ EPKLNY + WVRY+ ++G Sbjct: 396 YLKITEPKLNY---HAMPWVRYVTQNG 419 >SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 30.3 bits (65), Expect = 0.28 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 12 YLKVFEPKLNYSDHDVIKWVRYIGRSGLYETR 107 YL+V EP + S + IKWVRY R+G E R Sbjct: 416 YLRVSEP--SNSKYKSIKWVRYSTRAGTCEIR 445 >SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 948 Score = 26.2 bits (55), Expect = 4.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 454 IRKLKIIT*GISFNVQDCSLFHVPFK 377 IR K+ T I + +Q+CSL HVPF+ Sbjct: 183 IRPSKVHT-EIQWCLQNCSLIHVPFE 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,972,546 Number of Sequences: 5004 Number of extensions: 27687 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -