BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0366 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0373 + 28374298-28374380,28375126-28375303,28375975-283760... 36 0.041 10_08_1024 + 22371260-22371481,22371514-22372188,22372291-223732... 29 2.7 07_03_1436 - 26543846-26546806 29 2.7 11_04_0341 - 16565757-16566418,16566668-16567799,16567965-16568549 28 6.2 05_06_0262 - 26746180-26746278,26746371-26746493,26746584-267467... 28 6.2 01_06_0412 + 29159918-29160046,29160148-29160297,29160385-291604... 28 6.2 10_03_0002 - 6858257-6861205 28 8.2 >02_05_0373 + 28374298-28374380,28375126-28375303,28375975-28376065, 28376162-28376256,28376379-28376468,28376789-28376837, 28376941-28377079,28377224-28377340,28377437-28377527, 28377604-28377746,28378009-28378123,28378439-28378483, 28378565-28378645 Length = 438 Score = 35.5 bits (78), Expect = 0.041 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +3 Query: 12 YLKVFEPKLNYSDHDVIKWVRYIGRSGLYETRC 110 +LKV+E S ++ ++WVRYI R+G YE RC Sbjct: 410 FLKVWEK----SGYNTVEWVRYITRAGSYEIRC 438 >10_08_1024 + 22371260-22371481,22371514-22372188,22372291-22373236, 22389377-22389552 Length = 672 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 48 PSNSASVRTPSGSLVP 1 P+NSAS RTP+GS VP Sbjct: 150 PANSASTRTPTGSRVP 165 >07_03_1436 - 26543846-26546806 Length = 986 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 48 PSNSASVRTPSGSLVP 1 P+NSAS RTP+GS VP Sbjct: 326 PANSASTRTPTGSRVP 341 >11_04_0341 - 16565757-16566418,16566668-16567799,16567965-16568549 Length = 792 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 48 PSNSASVRTPSGSLVP 1 P NSAS RTP+GS VP Sbjct: 271 PVNSASTRTPTGSRVP 286 >05_06_0262 - 26746180-26746278,26746371-26746493,26746584-26746725, 26746824-26746921,26747012-26747108,26747215-26747322, 26747900-26748003,26748170-26748268,26748373-26748435, 26748538-26748687,26748769-26748900 Length = 404 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 12 YLKVFEPKLNYSDHDVIKWVRYIGRSGLYETR 107 YLK+ E S + + WVRYI +G YE R Sbjct: 375 YLKIIEK----SGYQALPWVRYITMAGEYELR 402 >01_06_0412 + 29159918-29160046,29160148-29160297,29160385-29160447, 29160540-29160716,29160796-29160899,29162142-29162249, 29162336-29162432,29162540-29162637,29162718-29162859, 29162941-29163063,29163161-29163259 Length = 429 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 12 YLKVFEPKLNYSDHDVIKWVRYIGRSGLYETR 107 YLK+ E S + + WVRYI +G YE R Sbjct: 400 YLKIIEK----SGYQALPWVRYITMAGEYELR 427 >10_03_0002 - 6858257-6861205 Length = 982 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 48 PSNSASVRTPSGSLVP 1 P NS SVRTP+GS VP Sbjct: 323 PVNSESVRTPTGSRVP 338 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,316,818 Number of Sequences: 37544 Number of extensions: 144065 Number of successful extensions: 198 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 198 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -