BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0365 (703 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.45 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 9.7 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 9.7 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 25.4 bits (53), Expect = 0.45 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +1 Query: 55 HCKNLKGYFRICLISVMAVIFKNANLLHLSKYKNTHVQTLFLSSLVRKFSVRSIFLSTL 231 +C L G + C+I VIF+ L H+ + +T V L + R+F + ++ L T+ Sbjct: 247 YCTTLIGLIKNCVI----VIFELYYLSHVCQNVSTEVIGNILRLMHRRFEITALRLFTI 301 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 481 HLLTIPKMFLTLMSFTYISL 422 +LL+IP M+L L+ ++ I+L Sbjct: 1035 YLLSIPSMYLLLILYSIINL 1054 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 481 HLLTIPKMFLTLMSFTYISL 422 +LL+IP M+L L+ ++ I+L Sbjct: 1035 YLLSIPSMYLLLILYSIINL 1054 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 481 HLLTIPKMFLTLMSFTYISL 422 +LL+IP M+L L+ ++ I+L Sbjct: 1035 YLLSIPSMYLLLILYSIINL 1054 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 481 HLLTIPKMFLTLMSFTYISL 422 +LL+IP M+L L+ ++ I+L Sbjct: 1035 YLLSIPSMYLLLILYSIINL 1054 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 450 VKNILGIVSKWYYKVSSLT 506 V NIL V+ W V+SLT Sbjct: 136 VLNILSDVTLWLSNVNSLT 154 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 450 VKNILGIVSKWYYKVSSLT 506 V NIL V+ W V+SLT Sbjct: 62 VLNILSDVTLWLSNVNSLT 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,591 Number of Sequences: 336 Number of extensions: 3057 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -