BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0363 (699 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40028-2|AAY55874.1| 1200|Caenorhabditis elegans Hypothetical pr... 28 5.6 Z81551-2|CAB04482.4| 413|Caenorhabditis elegans Hypothetical pr... 28 7.4 >U40028-2|AAY55874.1| 1200|Caenorhabditis elegans Hypothetical protein T05A7.11 protein. Length = 1200 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 115 GGCLPNSYQTTESFDKLFAVIWFMFPFSVFLSNTRSKIADQFIVISFLSTFIN 273 G + Y T F + +WF+F + + T + +QF I FL T N Sbjct: 753 GVTVNKKYCTEHKFYEHLKRVWFIFGLFLNIKKTILFLENQFFGIKFLKTLCN 805 >Z81551-2|CAB04482.4| 413|Caenorhabditis elegans Hypothetical protein F56A12.2 protein. Length = 413 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 440 RLA*KFNFSLLNISWSKMNK*SGTSNTRSPRFKLGFPSLNKYSYSTYS 297 + A + S +IS SKM+ + S+T S +F + FP+ Y + T S Sbjct: 142 KFASHYGRSRKSISASKMSTAAQPSSTESAKFTISFPAEMFYEFHTRS 189 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,005,873 Number of Sequences: 27780 Number of extensions: 304866 Number of successful extensions: 557 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -