BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0360 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 23 2.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 23 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.9 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 23.0 bits (47), Expect = 2.8 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +2 Query: 347 KYTYCFSNKMSSMTPKVVMFNLEIGEP-QTKSGNENEADHNKLEDMIKELATT 502 +Y CF + S +TP V F I E QT+ E L D + E TT Sbjct: 44 QYYDCFIDAGSCLTPDSVFFKSHITEAFQTQCKKCTEIQKQNL-DKLAEWFTT 95 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 23.0 bits (47), Expect = 2.8 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +2 Query: 347 KYTYCFSNKMSSMTPKVVMFNLEIGEP-QTKSGNENEADHNKLEDMIKELATT 502 +Y CF + S +TP V F I E QT+ E L D + E TT Sbjct: 44 QYYDCFIDAGSCLTPDSVFFKSHITEAFQTQCKKCTEIQKQNL-DKLAEWFTT 95 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 260 LHNI*ETTFCYFKR 219 ++N + TFCYF+R Sbjct: 530 IYNWFQNTFCYFRR 543 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,447 Number of Sequences: 438 Number of extensions: 4434 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -