BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0359 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 27 0.17 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.91 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.91 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 8.5 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 27.1 bits (57), Expect = 0.17 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 439 ATKGPKLLLSHPDLINYQNILINSFICFIN 528 AT+ P LLL+ P+LI ++ILI F F N Sbjct: 77 ATRSPFLLLNDPELI--KDILIRDFSKFAN 104 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 442 SHKRETGKQLMNRTIRYYTFYCYYPLH 362 +++ +G+ LM RT+R CYYP H Sbjct: 368 TNRYSSGRVLM-RTVRGKEKTCYYPYH 393 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 442 SHKRETGKQLMNRTIRYYTFYCYYPLH 362 +++ +G+ LM RT+R CYYP H Sbjct: 368 TNRYSSGRVLM-RTVRGKEKTCYYPYH 393 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 422 SGFPLVRQKDLSFC 463 SG+P +RQ S+C Sbjct: 23 SGYPSIRQGTTSYC 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,279 Number of Sequences: 438 Number of extensions: 3408 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -