BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0358 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0205 + 12649724-12650191,12651493-12652025,12652114-126522... 30 2.0 12_02_0093 + 13536684-13536782,13537055-13537057,13537626-135376... 29 4.7 01_06_1308 - 36159406-36159536,36159642-36160616,36161117-361612... 28 6.2 12_02_0797 - 23230441-23230757,23230922-23231069,23231352-232325... 28 8.2 03_02_0790 - 11212540-11212698,11212777-11212873,11212974-112130... 28 8.2 >04_03_0205 + 12649724-12650191,12651493-12652025,12652114-12652239, 12652625-12652724,12652880-12652899,12653035-12653137, 12653213-12653351,12653448-12653662,12653772-12654320 Length = 750 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 417 NVDNASAGECVQRPPRRDAGAGR-QGNRYAFTICLTQLNNNTQVAACSLLLNLSVALAQQ 593 NVDN VQ+P +R AGAG+ +G ++A T + V + L+ +A Sbjct: 643 NVDNTENKVEVQQPHKRTAGAGKGKGGKWARTSSAPGDADARNVVTSTETLD-GIAAENV 701 Query: 594 PDSVELAEC 620 D V++ +C Sbjct: 702 ADLVQIEDC 710 >12_02_0093 + 13536684-13536782,13537055-13537057,13537626-13537654, 13539481-13539572,13539979-13540049,13540178-13540266, 13540896-13541019,13541111-13541394,13541831-13541960, 13542482-13543111 Length = 516 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 333 CVDLFVPDSQPCYIQYREQ 277 C+D+F P+ Q I+YRE+ Sbjct: 265 CIDIFTPEEQKILIEYREK 283 >01_06_1308 - 36159406-36159536,36159642-36160616,36161117-36161245, 36161403-36161647,36161730-36161881,36161982-36162083 Length = 577 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = -3 Query: 569 VQ*QGTRRYLSVVIELCEAYGECITVSLAASTSISPGRSLNAFTSTRIVNIMFAGRLSGA 390 VQ QG R+ +++ A C T S+ PG L A R+V I + A Sbjct: 22 VQAQGITRHYEFNVQMANATRLCNTKSMVTVNGQCPGPELVAREGDRVV-IRVTNNV--A 78 Query: 389 NNVSRYW 369 +N+S +W Sbjct: 79 HNISLHW 85 >12_02_0797 - 23230441-23230757,23230922-23231069,23231352-23232562, 23232639-23232894,23234073-23234309 Length = 722 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 474 QHLSGEVAERIHQHSHCQHYVCR*VVWRQQCEQILDKVRSVF 349 QH + V E I+ S + + V QQC +LD V S+F Sbjct: 140 QHAASLVLEAIYLKSMSLQKLGKAVEAAQQCRSVLDAVESIF 181 >03_02_0790 - 11212540-11212698,11212777-11212873,11212974-11213030, 11213291-11213379,11213463-11213549,11213820-11213935, 11214026-11214281,11214361-11214510,11214948-11215106, 11215456-11215493,11215972-11216063,11216528-11216682, 11217185-11217253 Length = 507 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 524 LCEAYGECITVSLAASTSISPGRSLNA-FTSTRIVNIMFAGRLSGAN 387 + EA +++AASTS++PG+ + + +++ ++ GRL N Sbjct: 1 MAEAIASAGGIAMAASTSLTPGQGCGSKGVNHQVIAVLLYGRLVAPN 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,426,984 Number of Sequences: 37544 Number of extensions: 382890 Number of successful extensions: 1114 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -