BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0358 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29757| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_56375| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 29 3.6 SB_25129| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-24) 29 3.6 SB_54329| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.16) 29 4.8 >SB_29757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/81 (30%), Positives = 41/81 (50%) Frame = +1 Query: 259 EWPKEILFPVLDVTRLAVRNKQINAQMFDTKYGPNFVQYLLTLLAPDNLPANIMLTMRVL 438 +WP + LFPVLD+ RL VR++ + A + GP+ V+ LL + + Sbjct: 34 QWPADSLFPVLDIVRLVVRHQSLAANV----SGPDLVEQLLMISG-------------IF 76 Query: 439 VNAFSDLPGEMLVLAARETVM 501 N FS G+ ++L RE ++ Sbjct: 77 ANLFSSADGKAVILQYREKII 97 >SB_56375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/81 (30%), Positives = 41/81 (50%) Frame = +1 Query: 259 EWPKEILFPVLDVTRLAVRNKQINAQMFDTKYGPNFVQYLLTLLAPDNLPANIMLTMRVL 438 +WP + LFPVLD+ RL VR++ + A + GP+ V+ LL + + Sbjct: 157 QWPADSLFPVLDIVRLVVRHQSLAANV----SGPDLVEQLLMISG-------------IF 199 Query: 439 VNAFSDLPGEMLVLAARETVM 501 N FS G+ ++L RE ++ Sbjct: 200 ANLFSSADGKAVILQYREKII 220 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 513 CLTQLNNNTQVAACSLLLNLSVALAQQPDSVELAEC 620 CL+ N+ + AA +L NLS + +E+A+C Sbjct: 1224 CLSHQNDQVRFAAACVLRNLSSGTKSDQNKLEIADC 1259 >SB_25129| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-24) Length = 540 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 357 TELCPVSAHIVGARQPTGKHNVDNASAGECVQRPPRRDAGAGRQG 491 + LCP IV RQ N +++ + PPRR GA + G Sbjct: 412 SSLCPGKIDIVKNRQTNPARNHHRSASVSNMSGPPRRGTGASQVG 456 >SB_54329| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.16) Length = 313 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 469 SLRGGR*THSPALALSTLCLPVGC-LAPTM*ADTGQSSVRI*CRTSVR*SVCSG 311 S GGR TH L + C+ V C + T+ T ++ + C + R +C G Sbjct: 215 SYNGGRCTHKEELTVGKSCIHVACSVGSTVWLGTESGTLHVYCAITYR-ELCKG 267 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,031,443 Number of Sequences: 59808 Number of extensions: 439699 Number of successful extensions: 1195 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1195 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -