BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0357 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.59 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 2.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.4 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 4.2 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 7.3 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 7.3 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 25.0 bits (52), Expect = 0.59 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -3 Query: 304 EVYNKRIFFDYQ*FFPIKSQVVYATFSSAYSLV 206 ++ N+R F+ FFPI +V++ F+S+ ++ Sbjct: 1065 QILNERAEFNAAGFFPIDYTLVFSKFTSSIRML 1097 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 416 HFYIALLKP*YKAPEHVQHSYTAVL 342 H+Y LK KAP+ V Y ++L Sbjct: 3 HYYRLSLKSRQKAPKIVNSKYNSIL 27 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 416 HFYIALLKP*YKAPEHVQHSYTAVL 342 H+Y LK KAP+ V Y ++L Sbjct: 3 HYYRLSLKSRQKAPKIVNSKYNSIL 27 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 126 RRVRLNNTYNTYKTI 170 RR R+NN+ N KT+ Sbjct: 46 RRARINNSLNELKTL 60 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 179 NNPNGVKRCD*AVC 220 N+PN CD AVC Sbjct: 155 NDPNRAPPCDPAVC 168 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 279 KNIRLLYTSLTSN*FYLC 332 K+ ++LYTSLTS + C Sbjct: 58 KSWKVLYTSLTSFGYLFC 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,141 Number of Sequences: 336 Number of extensions: 3476 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -