BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0357 (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 27 2.6 SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Sch... 27 2.6 SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 27 3.4 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 4.5 SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|... 26 6.0 SPCC1682.11c |||DUF580 family protein|Schizosaccharomyces pombe|... 25 7.9 SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces po... 25 7.9 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 27.1 bits (57), Expect = 2.6 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = -1 Query: 411 LHRFTQTVV*SARTRSALIYSGTHSSYIDRISYLLAKYIINGYSLTISDF-FLLNLKLYT 235 LH + + +R L S + Y D L A Y+I GYSL+ D F L L++ Sbjct: 347 LHHLLENLSKESRLHILLQLSQLYYKYND--FQLSAAYVIRGYSLSFEDISFKLKFLLFS 404 Query: 234 PHSAAH 217 + H Sbjct: 405 FRLSIH 410 >SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Schizosaccharomyces pombe|chr 1|||Manual Length = 887 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 336 SYIDRISYLLAKYIINGYSLTISDFFL 256 S++ IS L +Y+ NG+S T+SD L Sbjct: 485 SFLCSISKLENRYLSNGHSATLSDLLL 511 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 466 SYVRVMYRTGHARIH--ISTFTSLYSNRSIKRQNTFSTHIQRYSL 338 S+ R + H R H + F+ + NR+ R + + H+Q+ L Sbjct: 36 SFTRKEHLRRHERTHENVKAFSCSFCNRAFARSDVLNRHVQQMHL 80 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 26.2 bits (55), Expect = 4.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 474 QLRHMYESCIVQGTRAFTSALLHRFTQTVV*SARTRSA 361 QL+H+YES + + + AF SA + + S + SA Sbjct: 235 QLQHIYESVVEEKSEAFASATSSKILSEMSASMASSSA 272 >SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 570 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 576 YNNLRVVFLLGYVIHSSRG*FMRRVRQIFP*NSF 475 YNNL +F +GY++ G + + Q FP F Sbjct: 139 YNNLNTLFYVGYIVGQFPGHY---IMQTFPLGKF 169 >SPCC1682.11c |||DUF580 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 77 LIDVWVRLHVELFLSNST 130 LI +WVRL LFL ST Sbjct: 306 LIFIWVRLFARLFLRGST 323 >SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 479 EF*GNICLTLLINHPRDE*ITYPNKKTTRKLL 574 E+ ICL + +N P+ E + +P TR+ L Sbjct: 1010 EYISRICLNIDVNDPKVETVVHPVLTLTREAL 1041 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,746,955 Number of Sequences: 5004 Number of extensions: 55200 Number of successful extensions: 104 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -