BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0357 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55790.1 68414.m06388 hypothetical protein 30 1.7 At1g55800.1 68414.m06390 hypothetical protein 29 2.2 >At1g55790.1 68414.m06388 hypothetical protein Length = 414 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 164 NYP-YSNNPNGVKRCD*AVCAAECGVYNLRFNR 259 NYP Y N +RCD EC + RF+R Sbjct: 188 NYPGYENKRGDGRRCDQPFLLGECSTFKFRFSR 220 >At1g55800.1 68414.m06390 hypothetical protein Length = 314 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 161 QNYP-YSNNPNGVKRCD*AVCAAECGVYNLRFNR 259 +NYP Y N RCD EC + RF+R Sbjct: 187 RNYPGYENKRGDGSRCDQPFLLGECSTFKFRFSR 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,633,285 Number of Sequences: 28952 Number of extensions: 264682 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -