BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0356 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 7.3 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 9.7 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 7.3 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 430 SRDRTDLDVIRENHKFLWEDDDVADTWKNN*PKNITTNSSKNI 558 S D D + +H DD V N P T S KNI Sbjct: 3 SSDHFDRESPNIDHNSCSSDDTVLSVGNENPPPEDTPLSFKNI 45 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 460 RENHKFLWEDDDVADTWKNN*PKNITTNSSKNI 558 +E H+ + +DDD D N+ +N SS ++ Sbjct: 281 KEEHESMDDDDDDDDDMSNSENQNPRFTSSPDM 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,085 Number of Sequences: 336 Number of extensions: 3324 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -