BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0356 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 26 4.5 SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual 26 6.0 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 107 NKRHLMLFCAKVNIYSEYYCQSCRFCV 27 N+ H L C +V Y+C +C+ C+ Sbjct: 397 NQSHYCLKCFQVKPPRSYHCGACKRCI 423 >SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 973 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 451 DVIRENHKFLWEDDDVADTWKNN*PKNITTNS 546 DV+ E H DTW N P N TT + Sbjct: 131 DVVYEYHPSSERHKSTNDTWSTNLPTNPTTTA 162 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,044 Number of Sequences: 5004 Number of extensions: 55308 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -