BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0356 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 2.8 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.9 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 487 DDDVADTWKNN*PKNIT 537 DDD D WKN KN+T Sbjct: 5 DDDSYDFWKNWDLKNLT 21 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect = 4.9 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +1 Query: 448 LDVIRENHKFLWEDDDVADTWKNN---*PKNITT 540 LD I EN D A TWK+N P+N+T+ Sbjct: 72 LDSIDENSMTYAADIFFAQTWKDNRLRLPENMTS 105 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = +1 Query: 481 WEDDDVADTWKNN*PKNITTN 543 W DD+ WK P + N Sbjct: 183 WTTDDLVFLWKEGDPVQVVKN 203 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = +1 Query: 481 WEDDDVADTWKNN*PKNITTN 543 W DD+ WK P + N Sbjct: 183 WTTDDLVFLWKEGDPVQVVKN 203 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,082 Number of Sequences: 438 Number of extensions: 3827 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -