BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0355 (701 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 51 3e-05 UniRef50_Q5LN79 Cluster: Conserved domain protein; n=7; Rhodobac... 33 5.1 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 50.8 bits (116), Expect = 3e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 157 FLLLRWVDELAAHLVLSGYWSP 92 FLLLRWVDEL AHLVLSGYWSP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_Q5LN79 Cluster: Conserved domain protein; n=7; Rhodobacteraceae|Rep: Conserved domain protein - Silicibacter pomeroyi Length = 528 Score = 33.5 bits (73), Expect = 5.1 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = -1 Query: 458 ILNGSKFSYINNIFDSIYILWSIGLSTESIRKGPK 354 I+ G + +Y++ +FDS +++S GL++ES GP+ Sbjct: 443 IVPGGRITYVHVMFDSHQVIYSEGLASESFLPGPQ 477 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,471,652 Number of Sequences: 1657284 Number of extensions: 13178637 Number of successful extensions: 26444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26443 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55785129165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -