BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0355 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0885 + 22268287-22268988 32 0.38 03_01_0438 + 3399203-3399297,3399389-3399480,3399638-3399750,340... 30 1.5 03_04_0006 + 16257288-16259522 30 2.0 >08_02_0885 + 22268287-22268988 Length = 233 Score = 32.3 bits (70), Expect = 0.38 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = -1 Query: 689 GPFIFTFFCTRICRC*N-IEDPLVELNYNSHDFLQHVWRPFLLH*DGVEREGTEARRS*Q 513 G IF C +CRC + +E L+ L + FL RP +L E + A + Q Sbjct: 112 GAIIFAS-CKSMCRCSSPLEAELLALREGIYLFLIWTLRPVIL-----ETDCLVALQMIQ 165 Query: 512 DREKSSTSCAKLSPTVRIILNGSK 441 +E++++ A L +R +LNGS+ Sbjct: 166 SKERATSELAYLVREIRDLLNGSR 189 >03_01_0438 + 3399203-3399297,3399389-3399480,3399638-3399750, 3400345-3400610,3400793-3400864,3401023-3401098, 3401241-3401339,3401432-3401586,3401679-3401783, 3401880-3401966,3402459-3402543,3402626-3402734, 3403468-3403544,3403635-3403715,3404137-3404328, 3404415-3404528,3404650-3404742,3404864-3404990, 3405075-3405151,3405455-3405502,3405588-3405657, 3405737-3405810,3405895-3406005,3406222-3406300, 3406936-3408320 Length = 1293 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +1 Query: 412 ESKILLM*LNLLPFKIIRTVGDSFAHD---VELFSRSCQL 522 + +ILL L+ LP K I +GDSFA D +++F++SC L Sbjct: 324 KQRILL--LSDLPRKQIEKLGDSFAKDLNHIDVFTKSCSL 361 >03_04_0006 + 16257288-16259522 Length = 744 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = -1 Query: 452 NGSKFSYINNIFDSIYILWSIGLSTESIRKGPKNGTTTA 336 +GSK ++++N F ++++ S GL +KGP + +TA Sbjct: 408 DGSKLAFVDNEFKAVWLADSHGLRVVYEKKGPNSVFSTA 446 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,668,064 Number of Sequences: 37544 Number of extensions: 367374 Number of successful extensions: 648 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -