BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0355 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7654| Best HMM Match : MAM (HMM E-Value=0) 29 2.8 SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 >SB_7654| Best HMM Match : MAM (HMM E-Value=0) Length = 164 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 539 LRVQLRLSEGGMVSTHAEGNHGNCSLIQQVDLQYFNTYKF 658 LRV ++ + V EGNH N L Q L +TYKF Sbjct: 92 LRVLVKTNTSETVVWQQEGNHDNMWLFAQSTLYSTDTYKF 131 >SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +3 Query: 84 NVYGLQ*PLNTRWAASSSTHLSNKKKTAYSFLFHSPPAYKRWWS*AFSKIEFSFHQTNHI 263 +V+GL+ T + + +T + L PP KR W ++ F+++ T+H Sbjct: 151 SVHGLKKSKTTPYHTQGNGLCERLNRTLHELLRTLPPDKKRRWPDHLRQLCFAYNATSHS 210 Query: 264 TSFLLVFIV 290 T+ F V Sbjct: 211 TTGYSPFFV 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,039,878 Number of Sequences: 59808 Number of extensions: 405311 Number of successful extensions: 693 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -