Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0355
         (701 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    25   3.0  

>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = +3

Query: 510 ILSTSSGFGSFAFNSVLVKEEWSPHMLKEIMGIVV-*FNKWIF 635
           I +  +GFG      V VK E +  M+K I+ IV+  F  W+F
Sbjct: 54  IFTMQTGFGMLESGCVSVKNEVN-IMMKNIIDIVLGGFTYWLF 95


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 729,505
Number of Sequences: 2352
Number of extensions: 14163
Number of successful extensions: 22
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)