BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0355 (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ246816-11|ABB45478.1| 603|Homo sapiens NADH dehydrogenase sub... 30 9.2 >DQ246816-11|ABB45478.1| 603|Homo sapiens NADH dehydrogenase subunit 5 protein. Length = 603 Score = 29.9 bits (64), Expect = 9.2 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 111 NTRWAASSSTHLSNKKKTAYSFLFHSPPAYKRWWS*AFSKIEF--SFHQTNHITSFLLVF 284 N WA + +T LS K Y + +P A WS + + S N +LL+F Sbjct: 65 NWHWATTQTTQLSLSFKLDYFSMMFTPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIF 124 Query: 285 IVCEVMIFKKNMLLE 329 ++ +++ N L + Sbjct: 125 LITMLILVTANNLFQ 139 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,722,156 Number of Sequences: 237096 Number of extensions: 2094323 Number of successful extensions: 6400 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6400 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -