BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0355 (701 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025726-2|AAO21421.1| 174|Caenorhabditis elegans Male abnormal... 27 9.8 AC025726-1|AAK73921.1| 658|Caenorhabditis elegans Male abnormal... 27 9.8 >AC025726-2|AAO21421.1| 174|Caenorhabditis elegans Male abnormal protein 20, isoform b protein. Length = 174 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -1 Query: 506 EKSSTSCAKLSPTVRIILNGSKFSYINNIFDSIYILWSIGLSTE 375 E + C + R+ ++F N DSIY+ S+G+ E Sbjct: 81 ESEESECRSTASDERLCRPSTRFLAFTNNLDSIYVCSSVGMRPE 124 >AC025726-1|AAK73921.1| 658|Caenorhabditis elegans Male abnormal protein 20, isoform a protein. Length = 658 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -1 Query: 506 EKSSTSCAKLSPTVRIILNGSKFSYINNIFDSIYILWSIGLSTE 375 E + C + R+ ++F N DSIY+ S+G+ E Sbjct: 81 ESEESECRSTASDERLCRPSTRFLAFTNNLDSIYVCSSVGMRPE 124 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,891,211 Number of Sequences: 27780 Number of extensions: 319860 Number of successful extensions: 650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -