BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0353 (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H4.15 |||ribosome biogenesis protein Tsr1 |Schizosaccharom... 27 2.4 SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 27 3.2 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 9.7 SPAC8F11.06 |||nuclear envelope protein |Schizosaccharomyces pom... 25 9.7 >SPAC23H4.15 |||ribosome biogenesis protein Tsr1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 286 FHVQNLLTNVLTLYSITPFGVSVFVILFTSSNHSSYSK 173 F N N+L LYS+ + + V FT+ HS Y + Sbjct: 560 FEYYNKPWNLLVLYSLLQYENKLTVSQFTAMQHSEYEE 597 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 175 KLYDALTNSIKWCTKLIHSIE*ARKCLLD*NELMHSER 62 K D N IK C + + ++CL D N MH ++ Sbjct: 85 KSVDREQNRIKECLLFVRQVRDFKECLQDLNRAMHHQQ 122 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 240 LHLLECPYLLFYLPHRIIVLIL 175 LH + C Y+ +PH+ I IL Sbjct: 850 LHQVTCSYISIRIPHKFIPFIL 871 >SPAC8F11.06 |||nuclear envelope protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 539 SNVNRILHVERIPYFFCIFG--IYTIFLYFCFCSAFFVKNKKKN 664 +NV+R + + Y +F + +IFLYF F F ++N +N Sbjct: 109 TNVHRDIPIVVSGYLQLMFNACVASIFLYFLFKIVFGIQNDVRN 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,173,556 Number of Sequences: 5004 Number of extensions: 36288 Number of successful extensions: 86 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -