BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0351 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999... 28 6.2 02_05_0007 + 24918163-24918420,24919360-24919410,24919411-249194... 28 6.2 >12_02_0800 + 23299674-23299678,23299714-23299791,23299876-23299920, 23300052-23300415,23300493-23300574,23300793-23300873, 23300974-23302106,23302202-23302350,23302426-23302516, 23303628-23305940 Length = 1446 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -2 Query: 541 ITKSKRIQKKNFTGNNLESQLTKWSLKKIIPQKKKV*RN 425 +TK+KR + + + L +L + +L++I+P +K N Sbjct: 1049 VTKTKRAEMERYVPKPLSKELQQQNLRQILPSEKSCEEN 1087 >02_05_0007 + 24918163-24918420,24919360-24919410,24919411-24919480, 24919645-24919830,24920127-24920275,24921310-24921417, 24921501-24921638,24922574-24922853,24922924-24923047, 24923197-24923312,24923612-24923619 Length = 495 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 185 FFSTEHANVALQDYFNVLIIILCFFYFLCSYNVFFFYIPYYV 310 F S A++ L YF + +++CF L S F IP V Sbjct: 319 FQSHNGAHLKLPSYFGAITVLVCFISALISLAFAFIIIPRQV 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,871,779 Number of Sequences: 37544 Number of extensions: 242233 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -