BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0351 (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC071589-1|AAH71589.1| 1131|Homo sapiens ADNP homeobox 2 protein. 31 3.0 AB020670-1|BAA74886.2| 1181|Homo sapiens KIAA0863 protein protein. 31 3.0 >BC071589-1|AAH71589.1| 1131|Homo sapiens ADNP homeobox 2 protein. Length = 1131 Score = 31.5 bits (68), Expect = 3.0 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -1 Query: 566 HFEYVIWRYHEIETDPKKKLHRQ*PRVSINKMVPKENYSTKKKSLKKSHFPSRLLHIV 393 HF Y+I Y + T+ + + VSI K+ P + Y KK + S + + HI+ Sbjct: 178 HFHYLINSYFGLRTEEMGEQPKTNDTVSIEKIPPPDKYYCKKCNANASSQDALMYHIL 235 >AB020670-1|BAA74886.2| 1181|Homo sapiens KIAA0863 protein protein. Length = 1181 Score = 31.5 bits (68), Expect = 3.0 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -1 Query: 566 HFEYVIWRYHEIETDPKKKLHRQ*PRVSINKMVPKENYSTKKKSLKKSHFPSRLLHIV 393 HF Y+I Y + T+ + + VSI K+ P + Y KK + S + + HI+ Sbjct: 228 HFHYLINSYFGLRTEEMGEQPKTNDTVSIEKIPPPDKYYCKKCNANASSQDALMYHIL 285 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,076,198 Number of Sequences: 237096 Number of extensions: 1542093 Number of successful extensions: 2619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2616 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -